.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00932

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00932
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26242,99287, 16764022 TM0645 Molecular Weight 24392.47 Da.
    Residues 213 Isoelectric Point 5.55
    Sequence mkslqalfggtfdpvhyghlkpvetlanliglsrviimpnnvpphrpqpeassaqrkymlelaiadkplf tlderelqrnapsytaqtlkawreeqgpeaplafiigqdsllnfptwhdydtildnthlivcrrpgypl emtqaqhqqwleqhlthtpddlhqlpagkiylaetpwlnisatlirerlekgescddllpenvlnyinq qglyr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0645

    Name: NAD synthase (nh3)
    Other genes that carryout this rxn: TM1253
    Metabolic Subsystem: NAD Metabolism
    Reaction: : atp + dnad + nh4 --> amp + h + nad + ppi
    Classification: EC:6.3.1.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0645
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch