.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00944

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Crystallized
    Target Id IDP00944
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26116,99287, 16764252 TM0891 Molecular Weight 26931.57 Da.
    Residues 242 Isoelectric Point 6.05
    Sequence msiqlngincfygahqalfditldcpegetlvllgpsgagkssllrvlnllemprsgtltiagnhfdftk tpsdkairelrqnvgmvfqqynlwphltvvqnlieapcrvlgltkdqalaraekllerlrlkpysdryp lhlsggqqqrvaiaralmmepqvllfdeptaaldpeitaqivsiihelaetnitqvivthevevarkta srviymenghivehgdagcfahpqteafknylsh
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0891

    Name: "2C-methyl-D-erythritol 2,4 cyclodiphosphate dehydratase"
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : 2mecdp + nadh --> h2mb4p + h2o + nad

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0891
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch