The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Crystallized
    Target Id IDP00945
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32813,99287, 16764337 TM0977 Molecular Weight 39830.19 Da.
    Residues 362 Isoelectric Point 5.31
    Sequence maqvfnfssgpamlpaevlklaqqelcdwhglgtsvmeishrgkefiqvaeeaeqdfrdllnipsnykvl fchgggrgqfagvplnllgdkttadyvdagywaasaikeakkycapqiidakitvdgkravkpmrewql sdnaaylhycpnetidgiaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpagltlv ivredllgkahescpsildytvlndndsmfntpptfawylsglvfkwlkaqggvaamhkinqqkaelly gvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvvggmrasiynampieg vkaltdfmidferrhg
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch