.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00957

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP00957
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26204,99287, 16764557 TM1202 Molecular Weight 29819.36 Da.
    Residues 265 Isoelectric Point 5.62
    Sequence mflvdshchldgldyqslhkdvddvlakaaardvkfclavattlpgyrhmrklvgkrdnvvfscgvhpln qdeaydveelrllaaeddvvamgetgldyfytpetkirqqasfihhiqigrelhkpvivhtrdaradtl ailreekvtdcggvlhcftedretagklldlgfyisfsgivtfrnaeqlrdaaryvpldrllvetdspy lapvphrgkenqpamvrdvaeymavlkgvaveelaqittdnfarlfhidasrlssir
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1202

    Name: D-glucose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glc-D[e] + h2o[c] --> adp[c] + glc-D[c] + h[c] + pi[c]

     
    Name: Maltotriose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1203 TM1837 TM1836 TM1839
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malttr[e] --> adp[c] + h[c] + malttr[c] + pi[c]

     
    Name: maltotetraose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + maltttr[e] --> adp[c] + h[c] + maltttr[c] + pi[c]

     
    Name: maltose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1836 TM1839 TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malt[e] --> adp[c] + h[c] + malt[c] + pi[c]

     
    Name: D-galactose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + gal[e] + h2o[c] --> adp[c] + gal[c] + h[c] + pi[c]

     
    Name: raffinose transport via ABC system (import)
    Other genes that carryout this rxn:TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + raffin[e] --> adp[c] + h[c] + pi[c] + raffin[c]

     
    Name: melibiose transport via ABC system (import)
    Other genes that carryout this rxn:TM1204 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + melib[e] --> adp[c] + h[c] + melib[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1202
    generated 12/2008
    Transmembrane protein

    HMM_TM1202

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch