The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP00958
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32160,99287, 16764573 TM1218 Molecular Weight 25477.87 Da.
    Residues 233 Isoelectric Point 6.46
    Sequence mnkillqcdnlckryqegtvqtdvlhdvsfsigegemmaivgssgsgkstllhllggldtptsgdvifsg qpmsklssaakaelrnqklgfiyqfhhllpdftalenvamplligkkkpaeidararemlhavglehra thrpselsggerqrvaiaralvnnprlvladeptgnldarnadsifellgelnrlqgtaflvvthdlql akrmsrqlemrdgrltaelslmgae
      BLAST   FFAS

    Ligand Information
    Model TM1218
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch