.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00959

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP00959
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32788,99287, 16764654 TM1303 Molecular Weight 43829.50 Da.
    Residues 408 Isoelectric Point 5.90
    Sequence mslsvtrenfdewmvpvyvpapfipvrgegsrlwdqqgkeyidfaggiavnalghahpalrealneqanr fwhigngytnepalrlakklidatfaervffcnsgaeaneaalklarkyahdrvgnhksgivafknafh grtlftvsaggqptysqdfaplppdirhaayndlnsasaliddntcavivepvqgeggvipatkaflqg lrelcdrhqallifdevqtgvgrtgelyaymhygvtpdilttakalgggfpigamlttqdyasvmtpgt hgttyggnplatavagkvldiintpemqngvrqrhdafierlntlnvrfgmfseirglglllgcvlqte fagkakliaqeaakagvmvliaggdvvrfapalnvsdeeiatgldrfalacerlqtggvpcg
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1303

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch