.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01019

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP01019
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26190,99287, 16763618 TM0228 Molecular Weight 28087.58 Da.
    Residues 262 Isoelectric Point 6.59
    Sequence midksafihptaivedgaviganahigpfcivgpqveigegtvlkshvvvngqtkigrdneiyqfasige vnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllminahvahdctvgnrcilanna tlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqdvppyviaqgnhatpfgvnieglkrrgfs reglvairnaykllyrsgktldeakleiaelaekhpevkaftefferstrgpir
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0228
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch