.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01024

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP01024
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32639,99287, 16764528 TM1172 Molecular Weight 10567.38 Da.
    Residues 97 Isoelectric Point 9.10
    Sequence msidrtsplkpvstvqtretsdtpvqktrqektsaatsasvtlsdaqaklmqpgvsdinmervealktai rngelkmdtgkiadslireaqsylqsk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1172
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch