The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP01025
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26354,99287, 16764551 TM1196 Molecular Weight 8639.07 Da.
    Residues 78 Isoelectric Point 3.98
    Sequence mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaekittvqaai dyinghqa
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1196

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn:TM1197 TM1198 TM1199 TM1194
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]


    Ligand Information
    Model TM1196
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch