The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP01026
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26374,99287, 16764618 TM1267 Molecular Weight 9389.15 Da.
    Residues 82 Isoelectric Point 4.52
    Sequence mttitlvneqnstgnpfsahmlceqraiqeityellqsqqhvsnkdiiakliekletekdvvqldiyrna leavlfqtpddi
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1267

    Name: thiazole phosphate synthesis
    Metabolic Subsystem: Thiamine Biosynthesis
    Reaction: : atp + cys-L + dxyl5p + tyr-L --> 4hba + 4mpetz + ala-L + amp + co2 + h + h2o + ppi


    Ligand Information
    Model TM1267
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch