.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01028

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP01028
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32376,99287, 16765051 TM1707 Molecular Weight 26326.69 Da.
    Residues 245 Isoelectric Point 5.96
    Sequence mtftasssscaitespvvvaldyherdkalafvdkidprdcrlkvgkemftlfgpqlvrdlqqrgfdvfl dlkfhdipnttaravaaaadlgvwmvnvhasggarmmaaardalapfskdaplliavtvltsmetsdlh dlgvtlspaehaerlarltqqcgldgvvcsaqeavrfkqafgaafklvtpgirpagseagdqrrimtpe qalsagvdymvigrpvtqsvdpaqtlkdinaslkrea
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1707
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch