.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01784

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP01784
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26234,99287, 16764733 TM1383 Molecular Weight 110987.18 Da.
    Residues 1020 Isoelectric Point 8.50
    Sequence manltrrqwlkvglavggmvtfglsyrdvakraidgllngtsgkvtrdrifgnalipeaqaqthwqqnpq qtiamtqcfgcwtqcgirarvnadgkviriagnpyhplsqehpidssvpfseameqlagesgldarsta cargatlleslysplrllepmkrvgkrgegkwqrisfeqlieevveggdlfgeghvdglraihapdtpi dakhpsfgpktnqllvtntsdegrdaflrrfalnsfgsknfgahgaycglayragsgalmgdldknphv kpdwenvefalfmgtspaqsgnpfkrqarqlasarlrenfqyvvvapalplstvladprgrwqpvmpgs dsalamgmirwimdnqrynadylaipgvqamqqageqswtnathlviadelptlagqhltlrhltpdge etpvvlntdgelvdastcrqarlfvtqyvtladgqrvtvksglqrlkeaaeklslaqyseqcgvpeaqi ialaetftshgrkaavishggmmagngfynawsvmmlnalignlslsggvfvgggkfngvsdgprynmn sfagkvkpsglsiarsktayeaseeyrdkiaggqspypakapwypfvagqltelltsalegypyplkaw isnmsnpfygvpglravaeeklkdprrlplfiaidafmnettaladyivpdthnfeswgftapwggvas kattarwpvvapathrtadgqpvsmeafciavakrlhlpgfgdraitdpqgntfplnraedfylrvaan iafmgktpvalanqedisltgvsrilpaiqhtlkadevgrvafiysrggrfapedsgyteqrlgnawkk plqiwnadvaahrhaitgerfsgcpvwyparlsdgraiddqfpigqwplklisfksntmssstaviprl hhvkpanlvalnpqdgeryglqhgdrvriitpggqvvaqisllngvmpgviaiehgyghremgatqhsl dgvpmpydpqiraginlndlgfadptrtitntwldwvsgaavrqglpakieri
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1383

    Name: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : 4c2me + atp --> 2p4c2me + adp + h

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1383
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch