.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01845

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP01845
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26426,99287, 16763407 TM0017 Molecular Weight 16756.70 Da.
    Residues 147 Isoelectric Point 9.69
    Sequence mktyiinsnciynegkyelrtvsnsqvikmtamrakclsfiienahleiierqkittalwgsrshyvnda nltqilylirrdlkalgindlfitiprqglkvnsditiiatdsetkgrkkqivrqtiaalttvfsvtlg slmylhih
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0017

    Name: pyruvate synthase
    Genes involved in rxn:TM0016 TM0018 TM0015 TM0017
    Metabolic Subsystem: Pyruvate Met
    Reaction: : coa + fdxo-4:2 + pyr <==> accoa + co2 + fdxr-4:2 + h
    Classification: EC:1.2.7.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0017
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch