.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01869

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP01869
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32373,99287, 16764813 TM1467 Molecular Weight 42588.36 Da.
    Residues 391 Isoelectric Point 5.48
    Sequence mqklinsvqnyawgsktaltelygianpqqqpmaelwmgahpksssrittangetvslrdaieknktaml geavanrfgelpflfkvlcaaqplsiqvhpnkrnseigfakenaagipmdaaernykdpnhkpelvfal tpflamnafrefsdivsllqpvagahsaiahflqvpnaerlsqlfasllnmqgeeksralavlkaalns qqgepwqtirviseyypddsglfsplllnvvklnpgeamflfaetphaylqgvalevmansdnvlragl tpkyidipelvanvkfepkpagelltapvksgaeldfpipvddfafslhdlalqetsigqhsaailfcv egeavlrkdeqrlvlkpgesafigadespvnasgtgrlarvynkl
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1467
    generated 12/2008
    Transmembrane protein

    HMM_TM1467

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch