.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01883

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP01883
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26272,99287, 16763506 TM0116 Molecular Weight 60621.49 Da.
    Residues 553 Isoelectric Point 5.98
    Sequence mfgypggavldiydalhtvggidhvlvrheqaavhmadglaratgdvgvvlvtsgpgatnaitgiataym dsiplvilsgqvatsligydafqecdmvgisrpvvkhsflvkqtediplvlkkafwlaasgrpgpvvvd lpkdilnpakkmpyawpetvsmrsynpttsghkgqikralqtlasakkpvvyvgggaisaacyaplrhi ietfnlpvvsslmglgafpathrqslgmlgmhgtyeanmtmhnadvifavgvrfddrttnnlakycpna tvlhididptsisktvnadipvvgdarlvleqmlellaqdapsqpqddirdwwqqieswrarqclkyda esesikpqavietlwrltkgdayvtsdvgqhqmfaalyypfdkprrwinsgglgtmgfglpaalgvkma lpkemvvcvtgdgsiqmniqelstalqyelpvlvlnlnnrylgmvkqwqdmiysgrhsqsymqslpdfv rlaeayghvglqinrpdelesklsealehvrnnrlvfvdvtvdgsehvypmqirgggmdemwlsktert
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0116

    Name: xylulokinase
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : atp + xylu-D --> adp + h + xu5p-D
    Classification: EC:2.7.1.17
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0116
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch