The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP01907
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32179,99287, 16764516 TM1160 Molecular Weight 40661.67 Da.
    Residues 372 Isoelectric Point 5.77
    Sequence mkydliiigsgsvgaaagyyatraglkvlmtdahmpphqqgshhgdtrlirhaygegekyvplvlraqtl wdelsthneepifvrsgvvnlgpadsaflanvarsaqqwqlnverldatalmtrwpeirvpdnyiglfe adsgflrselaittwlrlareagcaqlfnspvshihhddngvtietsegcyhaskalisagtwvkalvp elpvqpvrkvfawfkadgrystknrfpaftgempngdqyygfpaendelkigkhnggqliqapeerkpf aavasdgaeafpflrnvlpgiggclhgaactydnspdedfiidtlpghentlvitglsghgfkfapvlg eiaadfalgktpsfdltpfrlsrfsq
      BLAST   FFAS

    Ligand Information
    Model TM1160
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch