.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP02217

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP02217
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS80222,IDP02217, 56708107, YP_170003 Molecular Weight 67338.68 Da.
    Residues 615 Isoelectric Point 6.43
    Sequence mskytildkintpsdlklipesqlkilsaelraflvdtldvsgghfasslgateltvalhyvynapydn ivwdvghqtyihkiltgrkdklvtikkdggisgfpkrseseydtfgvghsstsisaalgmaiadrlqgk ssntvavigdgaitggmafealnhaggikedilvilndnemsisdnvgglsahfskiisggfynsirek gkevlknippifefvkkvetqtkgmfvpanffedlgfyyvgpidghdvtelvktlrilkdhkgpkllhv itkkgkgytkaesdpikfhhvapsfhsgenittkiskptysnifgdwicqkaakdkrlvgitpamkegs dlirfsqlyphryfdvaiaeqhavtfagglacqglkpvvaiystflqraydqvihdialqnldvlyavd raglvgadgathdgsfdlafmrcipnhvimtpsdeneayhmlefgyeyngpamvryprgagigaeitgs ldlelgkakivkqgskiailnfgtllplakqlaekyhatvidmrfvkpldeimldkvsqtheiiltlee nciaggagsavneyfvakdlsnkiivrnfglqdkflnhgtkdlllaqsklcvenisqeldkli
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch