.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP02343

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP02343
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26366,99287, 16763725 TM0345 Molecular Weight 18521.59 Da.
    Residues 162 Isoelectric Point 9.55
    Sequence mhfhkrtllsvatlgmlavsvvlmvvwvrnsnhssintneflcttrtvttiqpkdihadgslvldfkmkr itfqyeiktkdngvkilyrdvymknlhrtapgvytfevsqvkvfatdtagellshlrvlhpeaaneiri skvgektffyslnrqlynvctaq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0345

    Name: 3-phosphoshikimate 1-carboxyvinyltransferase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : pep + skm5p <==> 3psme + pi
    Classification: EC:2.5.1.19
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0345
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch