.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP02645

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP02645
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26276,99287, 16765093 TM1749 Molecular Weight 96209.95 Da.
    Residues 892 Isoelectric Point 6.20
    Sequence mavtnvaelnalvervkkaqreyasftqeqvdkifraaalaaadariplakmavaesgmgivedkviknh faseyiynaykdektcgvlseddtfgtitiaepigiicgivpttnptstaifkslislktrnaiifsph prakeatnkaadivlqaaiaagapkdligwidqpsvelsnalmhhpdinlilatggpgmvkaayssgkp aigvgagntpvvidetadikravasvlmsktfdngvicaseqsvvvvdsvydavrerfashggymlqgq elkavqnvilkngalnaaivgqpaykiaelagfsvpettkiligevtvvdesepfaheklsptlamyra kdfeeavekaeklvamggightsclytdqdnqpervayfgqmmktarilintpasqggigdlynfklap sltlgcgswggnsisenvgpkhlinkktvakraenmlwhklpksiyfrrgslpialdevitdghkrali vtdrflfnngyadqitsvlkaagvetevffeveadptlsvvrkgaelansfkpdviialgggspmdaak imwvmyehpethfeelalrfmdirkriykfpkmgvkakmiavtttsgtgsevtpfavvtddatgqkypl adyaltpdmaivdanlvmdmpkslcafggldavthaleayvsvlasefsdgqalqalkllkenlpasyh egsknpvarervhsaatiagiafanaflgvchsmahklgsqfhiphglanallicnvirynandnptkq tafsqydrpqarrryaeiadhlglsapgdrtaakiekllawlesikaelgipksireagvqeadflahv dklsedafddqctganprypliselkqilldtyygrdftegevaakkdvvaapkaekkakksa
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1749

    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman4[e] + h2o[c] --> adp[c] + glcman4[c] + h[c] + pi[c]

     
    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman6[e] + h2o[c] --> adp[c] + glcman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman6[e] + h2o[c] --> adp[c] + galman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman4[e] + h2o[c] --> adp[c] + galman4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1749
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch