.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP02649

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP02649
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32867,99287, 16765136 TM1795 Molecular Weight 48035.40 Da.
    Residues 441 Isoelectric Point 6.23
    Sequence myhgqlknilllslrfimdklsyasdsstsawntylqqiervapylgelspwvdtlrhpkralivdipvq mddgtirhfegyrvqhnlsrgpgkggvryhpdvdlnevmalsawmtikcaalnlpyggakggirvdpfs lsegelerltrrytseigiiigpqkdipapdvgtngkvmawmmdtysmnhgttvtgvvtgkpihlggsl grekatgrgvfvsgleaarraniavegarvavqgfgnvgseaarlfagagarvvaiqdhtatlfnatgi dmkaltawqtehkqiagfpgaetiasdafwrlemdilipaalegqitrqraealtcklvlegangptyp daddvlasrgilvvpdvvcnaggvtvsyfewvqdmasffwseeeinarmdkimtdaivhvwekaaeksc slrtaayivacerillarkdrgiypg
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch