.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP04055

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP04055
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32272,99287, 16763684 TM0301 Molecular Weight 91456.70 Da.
    Residues 836 Isoelectric Point 8.52
    Sequence mkfkqpalllfiagvvhcanahtytfdasmlgdaakgvdmslfnqgvqqpgtyrvdvmvngkrvdtrdvv fklekdgqgtpvlapcltvsqlsrygvktedypqlwkaakppdecadltaipqakavldinnqqlqlsi pqlalrpefkgiapedlwddgipaflmnysarttqtdykmdmvgrdnsswvqlqpginigawrvrnats wqrssqlsgkwqaaytyaerglyslksrltlgqktsqgeifdsvpftgvmlasddnmvpyserqfapvv rgiartqarvevkqngytiynttvapgpfalrdlsvtdssgdlhvtvweadgstqmfvvpyqtpaialh qgylkysllagryrssdsatdkaqiaqatlmyglpwnltayggiqsathyqaallglggslgrwgslsv dgsdthsqrqgeavqqgaswrlrysnqltatgtnffltrwqyasqgyntlsdvldsyrhngnrlwswre nlqpssrttlmlsqswgrhlgnlsltgsrtdwrnrpghddsyglswgtsigggslslnwnqnrtlwrng ahrkenitslwfsmplsrwtgnnvsaswqmtspshggqtqqvgvngeafsqqldwevrqsyradappgg gnnsalhlawngdygllggdysysramrqmgvniaggivihhhgvtlgqplqgsvalveapgasgvpvg gwpgvktdfrgdttvgnlnvyqentvsldpsrlpddaevtqtdvrvvptegavveakfhtrigaralmt lkredgsaipfgaqvtvngqdgsaalvdtdsqvyltgladkgeltvkwgaqqcrvnyrlpahkgiaglyqmsglcr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0301

    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0303 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan6[e] + h2o[c] --> adp[c] + glucan6[c] + h[c] + pi[c]

     
    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0303 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan4[e] + h2o[c] --> adp[c] + glucan4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0301
    generated 12/2008
    Transmembrane protein

    HMM_TM0301

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch