.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP04366

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP04366
    Molecular Characteristics
    Source Clostridium perfringens atcc 13124
    Alias Ids TPS80258,IDP04366, 110800274, NC_008261 Molecular Weight 29735.48 Da.
    Residues 262 Isoelectric Point 5.57
    Sequence mkkllfllisivilsilisgcsskkietkkdsntviigiddtfvpmgfknekgdivgfdvdlskeafkr mnlkvifqpidwsmketeltngnidliwngytmtherekkvaftnsylknrqvivtlsnsnintlndlk gktvttqdgsssldtlferpkltksfkngepvlfdsfndcfmdleagrsdavvcdeilaqyyifkndps kfhvltedlgeesysiglrknsnlidhlnktledmkedgtiakisnkwfgkdlek
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch