.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP04524

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP04524
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32245,99287, 16764486 TM1129 Molecular Weight 23971.22 Da.
    Residues 226 Isoelectric Point 6.22
    Sequence msllarleqsvhengglivscqpvpgspmdkpeivaamaqaaasagavavriegienlrtvrphlsvpii giikrdltgspvritpylqdvdalaqagadiiafdasfrsrpvdidslltrirlhgllamadcstvneg ischqkgiefigttlsgytgpitpvepdlamvtqlshagcrviaegryntpalaanaiehgawavtvgs aitriehicqwfshavkr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1129

    Name: S-adenosylhomocysteine nucleosidase reversible
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : ahcys + h2o <==> ade + rhcys
    Classification: EC:3.2.2.9
     
    Name: methylthioadenosine nucleosidase
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : 5mta + h2o --> 5mtr + ade
    Classification: EC:3.2.2.16
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1129
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch