The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP04525
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32493,99287, 16764900 TM1556 Molecular Weight 51054.59 Da.
    Residues 483 Isoelectric Point 5.88
    Sequence msasqnkkktlslglalipvismlllliigygimglrieplllcsaavaagiawwqgycwediinsvvdk lakampvimilicvggligswmfsgtipymvywglklispeyiliaaffltsvvsvctgtswgsagtvg valmgvaagldvslaaaagavvsgayfgdkisplsdstnfaaivadttlfehiqhllwttlpsfllaav vyliaghsnmlgevatpqrvtdiihsleslyhfnivlilppvivlwgairkkpviplmlsacvlalflg vimqglsikqgldafidgfdiamfpqgaegvvadvprllnrggmfsmmgtillvfcafsfagaltltga ltiiinrlltiihsvgqliaatigttilvtgatsdgklallvpaelfkdayrrmgldtknlsrtiedag tviepllpwtsagvymattlgvstldllpwaiqcyaaiffaliygfsgigiartasasekspqssvte
      BLAST   FFAS

    Ligand Information
    Model TM1556
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch