.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP05185

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site CSGID
    Status Work Stopped
    Target Id IDP05185
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS83932,IDP05185, 30259987, NC_003997 Molecular Weight 37336.96 Da.
    Residues 339 Isoelectric Point 9.35
    Sequence mkfskpffitvvllialviivpaalvipfakakvgekaasktppaiesipapgkvdtavqvavyrekqk kveslpmeeyvtgvvasemnasfeiealkaqalaartfvvqrmlsggkknnadvtdtvkdqvykskeel kkqwgnnyennlkkieeavsktagqvltyegkpisasffstsngrtenaadywgndypylksvdspwdq aspkftseqiftvadfqkrlgvkvladgkvgdikgrtegkrvkdvafqgktltgrdvrdklelrssdft wkqegdkivvttkgfghgvgmsqygangmaaegkkytdivahyykgveiktmndyegklmvkk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch