The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Soluble
    Target Id IDP90244
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS80284,IDP90244, 218930098, YP_002347973 Molecular Weight 40930.53 Da.
    Residues 375 Isoelectric Point 5.61
    Sequence micpvielaqqlikrpslspsdagcqeimiqrlaaigftiepmnfgdtlnfwawrgegetlafaghtdv vptgdeshwhsppfeptirdgmlygrgaadmkgslaamivaaerfvaahpdhkgrlafmitsdeeakat ngtvkvvealmarherldyclvgepsstdrvgdivkngrrgsitanlrihgvqghvayphladnpvhra mpalnelvatqwdegnaffpatsmqianlqagtgsnnvipgefyvqfnfrfsteltdslikqrvaalld rhqldytlewvlsgqpfltakgalvdavvnavkhyteitpqllttggtsdgrfialmgaqvvelgpvna tihkvnecvsaadlqllsrmyqkimeqlia
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch