.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90273

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90273
    Molecular Characteristics
    Source Toxoplasma gondii me49
    Alias Ids TPS80290,IDP90273, 211968791, EEB03987 Molecular Weight 122598.58 Da.
    Residues 1155 Isoelectric Point 6.41
    Sequence mdanasverlalsgpaetggeghacplaqgiapeapsvytpasgdssrgapqlaeeedplkprgneeeg ekkelnekekekesgekeektttgsppevewrcpiclvvnaptdltcpccegpkpgtlptsspassrps nsaspfaptagsgfhlvsavssssplssaslsssagfffggtsgrksegfrpdlatpapaalqvsvfqa fssvrssasapstvpaealergrgngesgegaqeaerqkrpagfvpvfaasaqtgesehelkkaaekee ketektcreekaaeetkqreeekaaeetkqreeekeaeeakqreeekeekkrlevklerpardetript amifmfgsgemdqmpfwrsaeededrevleprkvkefeekdviratsgamhsavltadgrcwtfgcgdg galgrgddlgdaalspatvsiddvtavacgdshtafltregelylagtyrdaygalgfpdfdagagvap tfishralpalvfsglnrpsisqvacgenhtaalevggasfyvwgsnefgqlgvssssstasaaqarde alvspqggecaladklgfllpqrrtvgelapsvrnlsirrifcgrcttflslsssfaspalsssatarf gerdasngeatqnveqalvgcgrnrqgevgcgaaagavvdkfeeirslrnvdlnfvgggqffsvalrtd gclytwgqsdftghgcsesygvveeprvleklagqvhwvqcgsdhclaatdagrlytwgagqnfqlgng edvdirrtpflvdpqlfdskfvlqahggsqhsmvlcwsgryapkdaeaktdlakaalrkrqrpdtdeee deaereskrrrpsaletgaeattgashaevglgdedgeraeqqegakedeekeagkagkveekhdavqg gakrprsagspahraashapgtkkdekesgkavseeaagapsgcdsdvedvtvdlqgseeaakkrkpss rgrgrvprrhsaapvekketasgrvsrakaaqgrekksgasekiekeaqkrgssgtakraeskqtskrp ssaasqqekpqtvprgkretsrppsrvgekkqretekpaarkgerkavkkteskaekkaekatgkkgat knarggapkksasagvtvkktiqkktgrkattptskraagkaaakrrpnsr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch