.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90283

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90283
    Molecular Characteristics
    Source Toxoplasma gondii
    Alias Ids TPS80304,IDP90283, 211969603, DS984767.1 Molecular Weight 23307.29 Da.
    Residues 224 Isoelectric Point 5.19
    Sequence mahggiylrqkrnfcpltvstvavvfvvfmgvlvnslggvavaadsggvrqtpsetgssggqqeavgtt edyvnssamgggqgdslaeddttsdaaegdvdpfpalanegkseargpsleerieeqgtrrryssvqep qakvpskrtqkrhrligavvlavsvamltafflrrtgrrspqepsgggggndagnnagnggnegrgegg eddrrplhpgsvnefdf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch