.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90357

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90357
    Molecular Characteristics
    Source Coxiella burnetii rsa 493
    Alias Ids TPS80326,IDP90357, 29654004, A9KC82 Molecular Weight 41641.75 Da.
    Residues 374 Isoelectric Point 5.87
    Sequence msetlnllkqlierpsitpndagcqtilidrlksvgfqcehlpfgevhnfwawhghqspfiifaghtdv vppgdetqwhsppftptekngyiygrgaadmksglaamvvaaenfvkqnpdhngtigfivtsdeegpae ngtqkvvdylqqknikldycivgeassneklgdaikigrrgsmhgeltiigkqghiayphladnpihrs fqafealaktkwdegnehftptsfqfynveagagaanvipatlkakfnfrfapihttqqlqqkveriln yyqlnydiqwnvssqpffsgngrlatfvrqaiqeichlntepntyggtsdgrfiattgcevielgpvnk tahhvneniciadlekltdiyfrtlqllt
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch