.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90706

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP90706
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168 = atcc 700819
    Alias Ids TPS80340,IDP90706, 15792375, NP_282198 Molecular Weight 40455.13 Da.
    Residues 365 Isoelectric Point 5.17
    Sequence mnakefliellkfksvtpnddgalnfiamelsdfeaffiekegiknllltkkfkdegehlafgghvdvv pagegwsnnafapvekegfiyargaqdmksgvaafvdaaknadfkgarlsliltsdeegeaiygtkavl ewmqerdmlpdyavvaeptcvkkigdsikigrrgsingkllirgkqghvaypekcinpvhdfapvlkll agfdldpgsaefspskivitdirggmgvcnvtpndlklmfnvrnspdtsledvksyvekichglnyele lkqsseafltnidnkivqkmnesvqkithevpelntkggtsdaryfakygvkvvefgvcndrihaider vsieefeklclvfkdlienf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch