The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP90907
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32452,99287, 16764020 TM0643 Molecular Weight 23122.12 Da.
    Residues 202 Isoelectric Point 6.25
    Sequence mrlwlvrhgeteanvaglysghaptpltekgigqaktlhtllrhapfdrvlcselerarhtarlvlegrd vpqhilpelnemyfgdwemrhhrdlthedaesyaawctdwqnavptngegfqaftrrverfisrldafs dcqnllivshqgvlslliarlltmpaaslwhfrveqgcwsaidicegfatlkvlnsravwrpe
      BLAST   FFAS

    Ligand Information
    Model TM0643
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch