.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90908

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP90908
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32508,99287, 16764553 TM1198 Molecular Weight 30047.77 Da.
    Residues 269 Isoelectric Point 7.10
    Sequence mflinghaqdqlavsdratqfgdgsfttarivdgnichleahlqrlqvaceklriafshwstlrqemtml atghdsgvlkviisrgsggrgysamncqaatrilsvsaypayysqwrkqgitltlspiplgrnpylagl khlnrleqvlirshleqtdadealvldsegwvteccaanlfwrtgdivftprldqagvngimrqfclrq laqspfqvlevqareeavrqadeiiicnalmpiipirayhgtsyssrtlfqflapfcehpn
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1198

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn:TM1197 TM1199 TM1196 TM1194
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1198
    generated 12/2008
    Transmembrane protein

    HMM_TM1198

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch