.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90923

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP90923
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32698,99287, 16764324 TM0963 Molecular Weight 48577.64 Da.
    Residues 430 Isoelectric Point 5.39
    Sequence mldpnllrnepdavaeklarrgfkldvdklraleerrkvlqvntenlqaernsrsksigqakargediep lrlevnklgeeldaakaeldtllaeirdialtipnlpadevpvgkdendnvevsrwgtprefdfeirdh vtlgemhsgldfaaavkltgsrfvvmkgqiarmhralsqfmldlhteqhgysenyvpylvnhdtlygtg qlpkfagdlfhtrpleeeadssnyaliptaevpltnlvrdeiidedqlpikmtahtpcfrseagsygrd trglirmhqfdkvemvqivrpedsmaaleemtghaekvlqllglpyrkiilctgdmgfgacktydlevw vpaqntyreisscsnvwdfqarrmqarcrsksdkktrlvhtlngsglavgrtlvavmenyqqadgriev pevlrpymngleyig
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0963
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch