.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90931

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP90931
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32290,99287, 16764688 TM1337 Molecular Weight 36752.78 Da.
    Residues 327 Isoelectric Point 5.78
    Sequence mshlaelvanaaaainqasdvaaldnvrveylgkkghltlqmttlrdlppeerpaagavinaakeqvqqa lnarkaelesaalnarlaaetidislpgrriengglhpvtrtidriesffgelgftvatgpeieddyhn fdalnipghhparadhdtfwfdatrllrtqtsgvqirtmkaqqppiriiapgrvyrndydqthtpmfhq meglivdtnisftnlkgtlhdflrnffeedlqirfrpsyfpftepsaevdvmgkngkwlevlgcgmvhp nvlrnvgidpeiysgfafgmgmerltmlrygvtdlrsffendlrflkqfk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1337
    generated 12/2008
    Transmembrane protein

    HMM_TM1337

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch