.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90944

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP90944
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32242,99287, 16764478 TM1121 Molecular Weight 5743.79 Da.
    Residues 55 Isoelectric Point 10.51
    Sequence manhrggsgnfaedreraseagrkggqhsggnfkndpqraseagkkggkssnrns
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1121

    Name: sn-Glycerol 3-phosphate transport via ABC system
    Other genes that carryout this rxn: TM1122 TM1120
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glyc3p[e] + h2o[c] --> adp[c] + glyc3p[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1121
    generated 12/2008
    Transmembrane protein

    HMM_TM1121

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch