.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90951

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90951
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS80376,IDP90951, 81545356, NC_002506 Molecular Weight 77497.45 Da.
    Residues 684 Isoelectric Point 5.91
    Sequence mpaqtssqlkhwfakitshspfffailndqhqyvmvnerycdiaglsseemvgmsdsqvlgehfyrhlk pfyerafnnehieseltlseidletslhfslspimindrvqylvfhaidtsekqilvrsleeseskyal lttllpdglmmvendciisanpsaarllgfddaqkllgenlsrlfidektktvfssqlaslltekplvc ltgprcgferkiqlhagctsllgnqsqlillqdadeapkqfsattqvdahidsltglynrhgftkrleq ciqnetplvmlyldidnfknindslghhigdkvikevaarlkrllpqqavlghlggdefglilpepehn rsaemladriislinqpfdlhhfskrlacsigsvrypgdgndarvllqnadtamyeakergrnrlikfn dqmnkearmrlwleielqkalqqnglevwyqpkvnardfsingaealvrwkhpvegyispgafipvaek agliehlgrvvmrevfatvkrwklqgilpgrvainispeqfgnpqlidylekllrttgldpnnitfelt esvvmsdsehtqqmlnaikklgftlsiddfgtgysslaylarfpidelkidrafisnidtlpkqltvie niinlgrslnltvvaegvetqqqatllsnlnchsiqgfhfyrpqpkheveelfaqnrrhrksl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch