.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90952

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90952
    Molecular Characteristics
    Source Escherichia coli uti89
    Alias Ids TPS80378,IDP90952, 122422986, Q1R8X2 Molecular Weight 85732.33 Da.
    Residues 749 Isoelectric Point 8.73
    Sequence mrinllfvclktpisessvlmfvehnliknikiftlaftltvvliqlsrlisplavihsnyiflawmpl cvmlsilfifgwrgvvpilcgmfctnlwnlhlsflqtavmigsqafavlcacailrwqlgtrwryglts ryvwqrlfwlglvapigikcsmylvgnffdfplkistffgdadaiftvvdllslftavliynmlfyylt rmivsphfaqilwrrdiapslskekraftlswlaalsvllllmctpyendfiagylvpvffiiftlgvg kirypflnltwavstlcllnynqnflqgvlteyslafilavlisfsvcllymvriyhrsewlnrrwhlq altdpltllpnfraleqapeqeagksfcclridnlefmsrhyglimrvhcirsiyrtllplmqenekly qlpgselllvlsgpetegrlqhmvnilnsrqihwnntgldmgygaawgrfdgnqetlqpllgqlswlae qscahhhvlaldsreemvsgqttkqvlllntirtaldqgdlllyaqpirnkegegydeilarlkydggi mtpdkflpliaqfnlsarfdlqvlesllkwlathpcdkkgprfsvnlmpltllqkniagriirlfkryy ispqavileiteeqafsnaessmynieqlhkfgfriaiddfgtgyanyerlkrlqadiikidgvfvkdi vtntldamivrsitdlakakslsvvaefvetpqqqallhklgvqylqgyligrpqplad
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch