.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90953

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90953
    Molecular Characteristics
    Source Vibrio fischeri es114
    Alias Ids TPS80380,IDP90953, 75354249, Q5E666 Molecular Weight 94780.59 Da.
    Residues 827 Isoelectric Point 5.15
    Sequence mlhksdkrlltfislmpialigiftlvlnaivihenqtkvgsliqslysdaltqekgrvkqqvdsiyeq iiyednlaeqtlkksiqyriedaysiihfiyqqneektkpeiikliadalrqtrfndgrgyffiydmdg tnlmhpifpeyegknlinftdihgkrvvedhvkmmrekgegfsqwwypkpdnkdeafekigyakyfepl diyigtgeyvidveediqqillawisevrygddgyifvfdhsgnilshqdkslintniynktdinpyef mntlnskfddnnsrfskylnrldafnngsdsqlsyikkydkwdwvisggvytdtnkrllekkekiliqq nqeelkkillltltlaliltllslsvskyvamrfnkfqdricndfkvlektknkmqymalhdgltqlpn rvmlesrieeeivkaqqsgkmialmfvdlddfkkvndhyghdvgdklltlissrfshfiekdeivarfg gdefvfcfsnltsqqdaelwvekiqsvfenvfsingkeittgcsigvamypkdatcsseliskadivly kskdvhkgaslffdksideqvsyefsleeelknaldkrevtlvyqpqidtktgeiygvevlsrwcnnkl gsvspvkfiavaeeigmidqlgdfvlqqacediqevmpngtnaimlsvnispkqlikkgflsrimkivs rtgidvsritfeitenilisdlksvspillelqklgfgislddfgtgysslsylnilpiteikidrsfv sslftndqseslikaiiaigascqmtvvaegvetkeqleklkeyqcdlvqgyyldkplsiselkakya
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch