.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90956

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP90956
    Molecular Characteristics
    Source Escherichia coli uti89
    Alias Ids TPS80382,IDP90956, 122423881, Q1RC78 Molecular Weight 74755.14 Da.
    Residues 661 Isoelectric Point 6.47
    Sequence mktvresttlynflgshnpywrltessdvlrfstteitepdrilqlsaeqaariremtvitsslmmslt vdesdlsvhlvgrkinkrewggnasawhdtpavardlshglsfaeqvvseahsaivildsrgniqrfnr lcedytglkehdvigqsvfklfmsrreaaasrrnnrvffrsgnayevelwiptrkgqrlflfrnkfvhs gsgkneiflicsgtditeerraqerlrilantdsitglpnrnamqelidhainqadnnkvgvvyldldn fkkvndayghlfgdqllrdvslailsclehdqvlarpggdeflvlasntsqsalealasriltrlrlpf riglievytscsvgislspehgsdsaaiirhadtamytakeggrgqfcvftpemnqrvfeylwldtnlr kalendqlvihyqpkitwrgevrslealvrwqsperglippldfisyaeesglivplgrwvildvvrqv akwrdkginlrvavnisarqladqtiftalkqvlqelnfeycpidveltescliendelalsviqqfsr lgaqvhlddfgtgysslsqlarfpidaikldqvfvrdihkqpvsqslvraivavaqalnlqviaegves akedafltknginerqgflfakpmpavaferwykrylkrt
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch