.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91033

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site CSGID
    Status Work Stopped
    Target Id IDP91033
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mrsa252
    Alias Ids TPS83934,IDP91033, 49240405, CAG39051 Molecular Weight 85128.89 Da.
    Residues 786 Isoelectric Point 9.24
    Sequence miiywcmtvnggnemkalllktsvwlvllfsamglwqvssaaeqhtpmkahavttidkattdkqqvppt keaahhygeeaatnvsasaqgtaddtnnkvtsnapsnkpstavsttvnetrdvdtqqastqkptrtatf klsnaktaslsprmfatnvpqttthkilhtndihgrlaeekgrvigmaklktvkeqekpdlmldagdaf qglplsnqskgeemakamnavgydamavgnhefdfgydqlkklegmldfpmlstnvykdgkrafkpsti vtkngirygiigvttpetktktrpegikgvefrdplqsvtaemmriykdvdtfvvishlgidpstqetw rgdylvkqlsqnpqlkkritvidghshtvlqngqiynndalaqtgtalanigkitfnyrngevsnikps finvkdvenvtpnkalaeqinqadqtfraqtaeviipnntidfkgerddvrtretnlgnaiadameayg vknfskktdfavtngggirasiakgkvtrydlisvlpfgntiaqidvkgsdvwtafehslgapttqkdg ktvltanggllhisdsirvyydmnkpsgkrinaiqilnketgkfenidlkrvyhvtmndftasggdgys mfggpreegisldqvlasylktanlakydttepqrmllgkpavseqpakgqqsskgsesgkdaqpigkd kvmdpakqpapskvvllpahrgtvssgregsdralegtavssksgkqlasmsapkgsthekqlpktgtd qssspaamfvlvagigliatvrrrkas
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch