.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91214

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP91214
    Molecular Characteristics
    Source Bifidobacterium longum subsp. infantis atcc 15697
    Alias Ids TPS80398,IDP91214, 189439474, NC_010816 Molecular Weight 58644.64 Da.
    Residues 540 Isoelectric Point 5.86
    Sequence mtarpraviigmmgagktrvgkevahmlrlpfadadveierevgmkipsyfeeygepafreveadliad mledfdgifslgggapmtsstqhalasyidhggrvvyldadpaeameranrgggrpmlngnansrwkkl fkqrdpvfrevanvhvhtrgltpqgaakkvidmvseravhvtgaaiepydvvigegamnhladvlgpkp akialihtqsvqrhsdrarallrqggyevsdivipdaepgktitvangiwerlgnegftrsdavvglgg gaatdlagfvaatwmrgvryvncptsllamvdastggktgintpqgknlvgsfytpagvladtktlatl pndifieglgevaksgfirdpeilhiledhaaelrafvgstflgspledvvaeliertvkvkvyhvssd lkekglreflnyghtmghaieklehfrwrhgnavavgmvyaaelahligyidqdlvdyhrsllaslglp tswhggsfddvlalmhrdkkargnelrfvvldeighvvhldnppadaveeafhriqq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch