.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91521

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP91521
    Molecular Characteristics
    Source Toxoplasma gondii me49
    Alias Ids TPS80406,IDP91521, 237834825, NZ_ABPA00000000 Molecular Weight 223929.75 Da.
    Residues 1990 Isoelectric Point 6.49
    Sequence mmklkemveaaeakveskppqaaeekapdqaaggaeedvaaapaeggegaepldqaeiekmlfdeslga qeytyeefldlidqppeergeaederkhwsyprrwkvvlwnlqiqnymddnfsafmefefggtreeckv hkgtsvliyatgqdknylrtpvipdvsnagpvdmhfrkafeyrgsyldlereklkikvweyrnwtlnhl eavyeeallnlatgethverdlykfikgrrsrrcrisfhlyfqelydfelsfvkwrlvqimpcptlqek ianrgknkggytreatigfkrhqladqakyvfqqrqvkremqkrdsqrellpgasrpemlggfadkgsa rlshlgfesamkmpnrgtrspsglesnrpedgnrnmeeiflqhqatilasdqleelpaslrpplskrrk gedkkdgnkadgpqvkmtislmhassmnkglglvsserpadgiprwdnlgeiyfrgtlrdldstyiqvv vedttapkvmrqigygqiplrgvvdysclstelgtpmwlalqakmegwghelkewcfgfvegtvmvahl pryrqlgevsesdsdrvylilrikdvdqivtpdnrpvvdsyvevsfdgtsrrtrtvrntlnpvwddevt iplrlpafrditesdvtrkgkvwldvwgtgpgyvdhlggcsfslyeiffnekhnkrnltamqridlean trqsyetrvfstsrrlafihkadrpstiqfeawtcpdilevsgidklpeperitttsnfpralrntyer lkrmyaeviekkglvnpdtgvgpprffdvefldqrkethyaptmvtrirppfgvdsessvfhycrcvpf avkrenlvftpefavqirsgnamdhsilmtslllglpafafvcvgtlwdkhmhawvatfhydddracgv vkfwetttglvytlkhrfrdpytlqrlsadpefgilkmmniqrrkrlsilgvsvdadtpdyisrsgedl vqsefptggaklpyrsldimfnnrnvwlniqdgnpakvwfdiwdvvsrsgetvplqaflassqtrlgrk etiasllqlklspfdtlrqsccdvrhprredrnaakhcsfprvfarlqsprtralaeqwyqfspglhdv ppcfivrgfgakvaewqfdraaqeiqgkvlsditafratrnlptkwnrddvldaflqmglellhqaata rdedfqlarlkledwkkafyskvpcsyrvrgaplhfntydsktisdaiianvdfvesrdrsaffslavm lynlpgelvstyvyicvtqkvtererrrilaqkekqsredaqrkarkqrrkaghegadngaedkqgaeg neeehgdaaaaavaeesvsaeavqgdeepkkvvkkgavprvkkrsydqvegtevaaiaierdffteaea pdfknlmsdvehainthlglspgrvrafqaryaekrivfavgppmddateadavssvalmeklrdilps maheegrfqevtgggatlqwdgpgtnildriaqeqatagegeqqtsegiptrdmqvdgtavleeageks dkkkkkkekkekkekkekkekkekkekkkkkggetaaepeeasavlapppvpvpaaaipsvllpadsed gekeqpkekkkekkekkkkkdgetdaepeeasavlapppvpvpaaaipsillptdgedgekektkekkt ekkkekhtekkhkkksealpesettavvtvtpgeedetsplvpvpssiasseapeppastrvtpapepk akpglsmgaallavrarsrlqrkhlaqqlssssssevsassasslspssssssdfaetrakadalrarl qaaqarlaaaretevsssetessetseasflssdgewdalwqsqraaamerqqrlqkmvsgvkaayrrl eeentrlaatrrrddklqrqveaereravellkeatrrakeekdliarqpppardwsdtvvlstpqifv nsqaacapfadsgrdeggrdewyevsdacsrraessnesrttagaklrqqqldlagrt
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch