.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91632

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP91632
    Molecular Characteristics
    Source Escherichia coli o157:h7 str. sakai
    Alias Ids TPS80418,IDP91632, 13361290, BA000007 Molecular Weight 21852.81 Da.
    Residues 196 Isoelectric Point 9.08
    Sequence mpvnatgvsfssfgisyhkdnsfrgtirgkndevvkcsmgersirfnvnkfsgciletvsrqstkdihg wvsdertvypsrvinqeidncclqknakisseerkmvfslvskefeltldvkaaqssinhiiignasfg kkmdalcdgmsravknsttdyianvladkfyqkhiapgvdivklrneipgymsrviqg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch