.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91639

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP91639
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS80434,IDP91639, 15609517, NC_000962 Molecular Weight 183272.08 Da.
    Residues 1682 Isoelectric Point 5.25
    Sequence mwfvqmadpsgallnicvsyritgdidlarlrdavnavarrhrilrttypvgddgvaqptvhadlrpgw tqydltdlsqraqrlrlevlaqrefcapfelsrdaplritvvrtaadehvlllvahhiawddgswrvff tdltqaysradlgadlgpehrpsaasgpdtteadlnywraimadppeplelpgpagtcvptswraarat lrlpadtaarvatmakntgctpymvllaafgalvhrythsddflvaapvlnrgagtedaigyfgntvam rlrpqsamsfrelltatrdiasgafahqrinldrvvrelnpdrrhgaermtrvsfgfrepdgggfnppg iecerydlrsnitqlplgfmvefdragvlveaehlveilepalakqmlrhfgvlldnalaapdntlsgl almderdaarlrevsrgerfdtpvktlvdlvneqttrtpdatavvyegqhftyhdlneasnrlghwlie qgigsedrvavlldkspdlivtalgvvksgavyvpvdpsypqdrldfiladcdaklvlrtpvrelagyr sddptdadrirplrpdntayliytsgttglpkgvavphrpvaeyfvwfkgeydvddtdrllqvaspsfd vsiaeifgtlacgarmviprpggltdigyltallrdegitamhfvpsllglflslpgvsqwrtlqrvpi ggeplpgevadkfhatfdallhnfygptetvinasrfkvvgpqgtrivpigrpkinttmhllddslqpv ptgvigeiyiggthvaygyhrragltaerfvadpfnpgsrmyrsgdlarrnadgdiefvgradeqvkir gfrielgdvaaaiavdptvgqavvvvsdlprlgkslvgyvtpaaggdgpadvgvdldrirarvaaalpe ymlpaayvvldeipitahgkidraalpepqiasdtefrapqtaterrlaqlfgellgrdrvgaddsffd lgghsllatklvaavrnafgvdvgvreifefatvtalaghidtldsdsarprltrvdhdgpvrlsssqm rswfnyrfdgpnavnnipfaaalhgpcdtnafaaaitdvvarheilrtvyreiggvphqiiqppaevpv rcaagsdaawlraelnnergyvfdletdwpiraallstpeqtvlslvvhhiagdhwsagvlftdlltay rarstgqrpswaplpvqyadysvwqsallddgagivgpqrdywirqlgglagetglrpdfprpallsga gdavefrlgaairdklaavsrdlgvtefmllqaavavvlhkagggvdvpigapvagrseanldqligff inivvlrndlrgnptlrevlqrtrqmalaayahqdlpfdqvveavnpqrslsrnplfdivvhvreqmpq dhvidtgpdgdttlrvleptfdaaqadlsvnffacgdeyrghviyrtelyerataqrfadwlvrvveaf adrpdqplrevemvsaqarrrildrsnagagtarvyllddalkpvpvgvvgdvyygggpavgarlarps etatrfvadpfaaqpgsrlyrngergvwkadgqlellaeierlptaqaapvpaepadteteralaaila dvlevgevgryddffnlggdsilatqvaarardggipltarmvfehpvlcelaaavdakphveaepddk hhapmstsglspdelsaltaswdqwp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch