.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91763

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP91763
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS80458,IDP91763, 15601202, NC_002506 Molecular Weight 37271.52 Da.
    Residues 334 Isoelectric Point 5.93
    Sequence mlyakalsigdkigffspsspatafapnrfqrakaylkaqgfelvegsltgksdyyrsgsireraeeln qlirdpnvrcimptiggnnsnsllpyidyealrndpkiiigysdvtalllgiyaqtglitfygpalvas fgeypplvdetfhsfidllcsetnqyqytmpsswtdikhdwetqhsakpvypnewqfigkgkvtgriig gnlntmagiwgsrympeikvgdilliedslkgienversfahlaacgvfervsaiilgkhelfdnkgtg rtpldvlievladknvpifygfdschthpmlvtplgvrgtidfdnhtfkledrwvkak
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch