The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Soluble
    Target Id IDP91767
    Molecular Characteristics
    Source Escherichia coli str. k-12 substr. mg1655
    Alias Ids TPS80466,IDP91767, 16129542, NC_000913 Molecular Weight 21885.94 Da.
    Residues 186 Isoelectric Point 6.20
    Sequence mpsahsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvecdgeka glvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklylivdkenekaihiyrkl gfsvegelmheffingqyrnairmcifqhqylaehktpgqtllkptaq
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch