.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP91815

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP91815
    Molecular Characteristics
    Source Escherichia coli str. k-12 substr. mg1655
    Alias Ids TPS80478,IDP91815, 1790393, NC_000913 Molecular Weight 99057.22 Da.
    Residues 883 Isoelectric Point 5.52
    Sequence mneqysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnlsndell pvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtikkaveslslelvltah pteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqliaqswhtdeirklrpspvdeakwgfa vvenslwqgvpnylrelneqleenlgyklpvefvpvrftswmggdrdgnpnvtaditrhvlllsrwkat dlflkdiqvlvselsmveatpellalvgeegaaepyrylmknlrsrlmatqawlearlkgeelpkpegl ltqneelweplyacyqslqacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylg igdyeswseadkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysdsakdagvma aswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgslkgglrvteqgemirfky glpeitvsslslytgaileanllpppepkeswrrimdelsviscdvyrgyvrenkdfvpyfrsatpeqe lgklplgsrpakrrptggveslraipwifawtqnrlmlpawlgagtalqkvvedgkqseleamcrdwpf fstrlgmlemvfakadlwlaeyydqrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaes iqlrniytdplnvlqaellhrsrqaekegqepdprveqalmvtiagiaagmrntg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch