.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP92085

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP92085
    Molecular Characteristics
    Source Toxoplasma gondii me49
    Alias Ids TPS80654,IDP92085, 237830977 Molecular Weight 29676.91 Da.
    Residues 258 Isoelectric Point 7.12
    Sequence mfaavarrtatgtlpgavtlfgrksfegyyrdyplhprnfgvmaslfstgkfelpalpydynalepyis aktlkfhhdkhhatyvknlnelikgtdyenqklediirnadgptfnnaaqawnhtffwnsmkpngggep tglvkeqidrcfssfskykeefsekatkhfgsgwawlvwcnekrrleviethdagnpitmkkwpiitcd lwehgyyldrqndrgayvkswwsvvnwdfaneklekamrgdpidetvgggq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch