The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Soluble
    Target Id IDP92107
    Molecular Characteristics
    Source Toxoplasma gondii me49
    Alias Ids TPS80698,IDP92107, 237838437 Molecular Weight 46918.81 Da.
    Residues 423 Isoelectric Point 7.14
    Sequence medskdkaafstfcrqlsaafrhdliqraeekffrsqltsvsrlsppdvvlfvavasqlrqlllkserd aaacpgtlsetsvqngcsegawcellqgkniatvffepstrtrcsfeaatlrlggrviscgdmqtnsst kkgesledsirmfaaysdcivlrhpekgsmeratralkdvrvgrppccllsagdgagehptqalldllt vvqlrprwweaqlkkiegdsscirdpneknnlvehqpeatlrvafvgdlkngrtvhslalllsrfdchl tavsteasalpasvaervrenfkaqglsgeerlicssdfpeairtsdvlymtrlqserldhpvvptsgq qfppsdyqltrgllekharphlkvmhplprreeiavdvddtnhcayftqaenglymrmallsvflnrgt armllgqas
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch