.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP92113

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP92113
    Molecular Characteristics
    Source Toxoplasma gondii me49
    Alias Ids TPS80708,IDP92113, 237841001 Molecular Weight 70662.67 Da.
    Residues 644 Isoelectric Point 5.66
    Sequence msrtfggrdgtvketagleelspehtflmsddshrgqrlrdevldqlrtvidpdlhkdivslgfvrdle iqehagsvkfrlrlttpacpvkdlfvstctarlqgldwvhqvdiqldsqkssgstasgpgardglkrvs fvlavtsckggvgkstvavnlafmlrrlgakvglldadlygpslpvllpledtnvyfeeesegedyade rrneidvrpkrttarghsrahsshgrsiafeqtkrqdrdagarekktcasgkeddgekrqpklrplvyn gvkimsygfirnsgsqgfsalrgpfassvieqlltgtawrdldylvidfppgtgdihitlsqavnidac vvvttpqtlsttdaergikmfnelgipticivnnmahfvcdgcqkkhilfpgqqnvekladlaeaphvv qipldprlsqvvgaeesadeptqddaqssgesytfpvverlrkhprdkvysvfhelaaivvrelstlry gyvgpsvmlsgdsyveiglprrirrpciadadkpwtspignsddqeaaatgnaitsdphavsvnvctis lrrirdacqckscaaevrrdqlsgqnarnsgelaltevlhasnrslifvwddghrtalplqtverlale edeiqsrangsvcmagaqpelew
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch